DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and CG6678

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:226 Identity:52/226 - (23%)
Similarity:85/226 - (37%) Gaps:55/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKRLISGPNQSAVICESGRLFVWGENHYGQLGIGGHGGASGKKGGGSHNGNGDIVTKPTCVKALK 96
            ||:|..|...:.::..:|.:|.||....||||:                ....:...|..::|| 
  Fly   176 VKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL----------------AELRVEETPQLLEAL- 223

  Fly    97 TLGLKICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVD---QQPCAIIRKP--F 156
             .|:||..:|.|...:..::...:::..|.|            .|.|:.   .:|..::::|  |
  Fly   224 -AGIKITQIAAGGWHSAAISAFGDLYTWGLN------------CSGQLGLRVMKPGGVLKEPTVF 275

  Fly   157 RLEEFDDY-----LSKNEETDNF--MTVQAGKEHFAVLTTTGRLIGCGSNAQLQLGELEAD---- 210
            .|.:..|.     ....|..|:.  :.|.||..|..::...|||...|.....|||....|    
  Fly   276 PLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYV 340

  Fly   211 -----YDGHPVEIRLDAPVQQFTCGPESTLV 236
                 .:|    |.::..|....|||.|||:
  Fly   341 DAFQALEG----ITMNPTVDDVLCGPWSTLL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 52/226 (23%)
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 52/226 (23%)
RCC1_2 176..205 CDD:290274 8/28 (29%)
RCC1 192..241 CDD:278826 16/66 (24%)
RCC1_2 228..257 CDD:290274 6/40 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.