DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Als2

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001013431.1 Gene:Als2 / 363235 RGDID:1310372 Length:1651 Species:Rattus norvegicus


Alignment Length:664 Identity:131/664 - (19%)
Similarity:226/664 - (34%) Gaps:195/664 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GLKICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDD 163
            |..:...|.|....|:||...|::..|  ..|..:..|:...|:.:.:.  |::           
  Rat    40 GKTVLQAALGVKHGVLLTEDGEVYSFG--TLPWKSEAAEICPSSPLLES--ALV----------- 89

  Fly   164 YLSKNEETDNFMTVQAGKEHFAVLTTTGRLIGCGSNAQLQLGELEADY--DGHPVEIR------- 219
                   ..:.:||..|..|...:|.:|.:...|.||..|.......|  :..||.|.       
  Rat    90 -------GHHVVTVATGSFHSGAVTESGVVYMWGENAAGQCAVANQQYVSEPSPVSISDSETSPL 147

  Fly   220 LDAPVQQFTCGPESTLVLTATGNLFLTGHLNEFVFPRFTELQKNL-----PPTEAIIFMHISKTS 279
            |...:.|..||.|.||.|:.:..::..|          |..|..|     |.|:.....|::...
  Rat   148 LAVRILQLACGEEHTLALSISREIWAWG----------TGCQLGLITTTFPVTKPQKVEHLAGRV 202

  Fly   280 EVYIVTNAGSIYRSFESLRNKSLVFQRFYDYDC---EENGPIWKLLKGFSFYAVLSKANKFFTTF 341
            .:.:...|      |.||   :||       .|   ::..|:.:.         .::.::...|.
  Rat   203 VLQVACGA------FHSL---ALV-------QCLPPQDLKPVPER---------CNQCSQLLITM 242

  Fly   342 SESGHHLKTFREISKFKNLRLLDIAVGDQHVLVQGIPRSSMSS---ASVNGSAEPNRYVNRSFVL 403
            ::...|                 :.:.|.|....|:..|...:   ||...|..|.....:..|.
  Rat   243 TDKEDH-----------------VIISDSHCCPLGVTLSESQAEKHASTVTSPHPETLDGQGEVF 290

  Fly   404 QPT--DANGNKEDTRTHSGRSLIKQEGMEETEDLSMSTTVGELAAAAGAGTAAAMEAVKHLINGE 466
            :.|  :|..|....:|.||.::..|:.:           || :|..:.|.||.:.          
  Rat   291 ENTVAEAELNMGSDQTTSGSAISAQQNI-----------VG-MAEVSSARTAPSY---------- 333

  Fly   467 KPEEKSDLTRYQDLNANIESADIIPKEHKEAKGSDEIGPNSNISEKEEDNQIADRVTPGNKNESA 531
             |:.::.....|.|:           ||             ::.|..|..:...:|.| ...|:.
  Rat   334 -PDTQTVTAYLQKLS-----------EH-------------SVKENHEREEKLPQVQP-LVEEAV 372

  Fly   532 ADQEKSVHSPNTAATS---EAIKTNDGYKEMKPSATIESPVITADTKESSLKPIVSPVKTKRSPA 593
            .|    :|||.|.:||   ..:.:......::.:||.|:..:       |||.:::...|  :|.
  Rat   373 PD----LHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGAL-------SLKKVMNFYST--APC 424

  Fly   594 KTIESSIKSSSSPVKPTESMQKLPTPPTHTPTPPNSPTESLRSNKSAHDMELVDPKPK------- 651
            :....|..:|:.|    ||::.|        .......|||:..||:..|::.:.:.:       
  Rat   425 EPGAPSGTASTGP----ESLKDL--------REEQVKQESLQGKKSSSLMDIREEESEGGSRRLS 477

  Fly   652 VPG--SQET--LLRPR----------TP-YPESSNSSTPQTIKKTPIRNFSYESAMDH-DHLERT 700
            :||  ||.:  |||..          || |...:::..|....:........|..:.| |.|.|.
  Rat   478 LPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHGDVLPRL 542

  Fly   701 SPELVSSLDTVEEV 714
            .|..|..||..|.:
  Rat   543 QPLCVKCLDGKEVI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 36/169 (21%)
Als2NP_001013431.1 RCC1 1 59..108 10/70 (14%)
RCC1_2 93..122 CDD:290274 9/28 (32%)
RCC1 2 109..167 17/57 (30%)
RCC1 109..165 CDD:278826 16/55 (29%)
RCC1 3 169..218 13/74 (18%)
RCC1 170..216 CDD:278826 11/64 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..476 6/31 (19%)
RCC1 4 519..570 10/38 (26%)
RCC1 521..568 CDD:278826 10/36 (28%)
RCC1 5 572..621
RCC1 573..619 CDD:278826
RhoGEF 689..873 CDD:295373
PH_alsin 899..1004 CDD:241423
PH 920..998 CDD:278594
COG4642 1043..1182 CDD:226989
MORN 1 1043..1065
MORN 1043..1063 CDD:280628
MORN 2 1066..1088
MORN 3 1094..1116
MORN 1094..1114 CDD:280628
MORN 4 1117..1139
MORN 5 1145..1167
COG4642 1166..>1266 CDD:226989
MORN 6 1169..1191
MORN 7 1192..1214
MORN 8 1215..1238
VPS9 1548..1647 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.