DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Rcbtb1

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001101850.1 Gene:Rcbtb1 / 361050 RGDID:1308467 Length:531 Species:Rattus norvegicus


Alignment Length:450 Identity:98/450 - (21%)
Similarity:148/450 - (32%) Gaps:141/450 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SGPNQSAVICESGRLFVWGENHYGQLGIGGHGGASGKKGGGSHNGNGDIVTKPTCVKALKTLGLK 101
            |||: ..:..|.|.::.||.|.|.|||.|              ..|..|.....|...|..   :
  Rat    83 SGPH-VLLSTEDGVVYAWGHNGYSQLGNG--------------TTNQGIAPIQVCTNLLVK---Q 129

  Fly   102 ICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDDYLS 166
            :.:||.|:|.::.|....|:|..|.|      :..| ..|.....||..  ||          ::
  Rat   130 VVEVACGSHHSMALAADGELFAWGYN------NCGQ-VGSGSTANQPTP--RK----------VT 175

  Fly   167 KNEETDNFMTVQAGKEHFAVLTTTGRLIGCG--SNAQLQLGELEADYDGH---PVEIRL--DAPV 224
            ....|...:.:..|:.....:..:|.:.|.|  .|.||.||.     :|:   ||.:..  ...|
  Rat   176 NCLHTKKVVNIACGQTSSMAVLDSGEVYGWGYNGNGQLGLGN-----NGNQLTPVRVAALHGVCV 235

  Fly   225 QQFTCGPESTLVLTATGNLFL----------TGHLNEFVFPRFTELQKNLPPTEAIIFMHISKTS 279
            .|..||...||.||..|.|:.          ||..|..:.|  |::.........|...|.:.||
  Rat   236 NQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGSKNNLLSP--TQIMVEKERVIEIAACHSTHTS 298

  Fly   280 EVYIVTNAGSIYRSFESLRNKSLVFQRFYDYDCEEN--------GPIWKLL--KGFSFYAVLSKA 334
            ..  .|..|.:| .:...|.:|::......:.|.::        ...|:||  :...|..|....
  Rat   299 AA--KTQGGHVY-MWGQCRGQSVILPHLTHFSCTDDVFACFGTPAVSWRLLSVEHEDFLTVAESL 360

  Fly   335 NKFFTT-------FSESGHHL-----------KTFR---------------EISKFK-------- 358
            .|.|.:       |...|.::           :.||               ||.:|.        
  Rat   361 KKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPVYRAFL 425

  Fly   359 --------------NLRLLDIAVG---------DQHVLVQGIP---RSSMSSASVNGSAE 392
                          .:.|||:|..         .||::.:||.   ..|:.||:|...||
  Rat   426 QYLYTDTVDLPPEDAIGLLDLATSYCENRLKRLCQHIIKRGITVENAFSLFSAAVRYDAE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 60/239 (25%)
Rcbtb1NP_001101850.1 RCC1 42..89 CDD:395335 3/6 (50%)
ATS1 <91..363 CDD:227511 72/317 (23%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 17/115 (15%)
BACK_RCBTB1 466..531 CDD:350603 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.