DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Rcc1l

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001101802.1 Gene:Rcc1l / 360796 RGDID:1307558 Length:461 Species:Rattus norvegicus


Alignment Length:269 Identity:59/269 - (21%)
Similarity:96/269 - (35%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSHLAENTQSYFYIKNDPVKRLISGPNQSAVICESGRLFVWGENHYGQLGIGGH---------GG 69
            :||.....|.:    ...|.:::.|.:.|..:.:.|.::..|....||.|:|.:         ||
  Rat   215 ESHKVHRMQDF----EGQVVQVVCGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSTPSKLGG 275

  Fly    70 ------------------ASGKKGGGSHNGNGDI-----VTKPTCVKALKTLGL----KICDVAF 107
                              |....||....||.:.     ||..|.|...:.|..    |:..||.
  Rat   276 DLAGVTVVQVATYGDCCLALSADGGVFGWGNSEYLQLASVTDSTQVNVPRCLPFSGVGKVKQVAC 340

  Fly   108 GNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDDYLSKNEETD 172
            |.....:|.....:|..|..|..:..::::   :|..:..|..:    |.|.||:..:..::   
  Rat   341 GGTGCAILNEEGHVFVWGYGILGKGPNLSE---TALPEMIPPTL----FGLTEFNPEVKVSQ--- 395

  Fly   173 NFMTVQAGKEHFAVLTTTGRLIGCGSNAQ--LQLGELEADY-------DGHPVEIRLDAPVQQFT 228
                ::.|..|||.||..|.|...|.|.:  |.:|.||..|       .|.||::         .
  Rat   396 ----IRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDV---------A 447

  Fly   229 CGPESTLVL 237
            ||.:..:.|
  Rat   448 CGVDHMVTL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 59/269 (22%)
Rcc1lNP_001101802.1 RCC1 127..186 CDD:278826
RCC1_2 173..202 CDD:290274
RCC1 192..242 CDD:278826 6/30 (20%)
RCC1_2 229..258 CDD:290274 5/28 (18%)
RCC1 245..295 CDD:278826 8/49 (16%)
RCC1 298..348 CDD:278826 13/49 (27%)
RCC1_2 393..422 CDD:290274 10/35 (29%)
RCC1 409..452 CDD:278826 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.