DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Rccd1

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:XP_006229517.1 Gene:Rccd1 / 308760 RGDID:1309901 Length:378 Species:Rattus norvegicus


Alignment Length:239 Identity:62/239 - (25%)
Similarity:99/239 - (41%) Gaps:65/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKRLISGPNQSAVICESGRLFVWGENHYGQLGIGGHGGASGKKGGGSHNGNGDIVTKPTCVKALK 96
            |::|..|...:.::||:|::|.||...:|||   |||....:             .:|..::||:
  Rat   163 VRQLQLGAEHALLLCEAGQVFSWGGGRHGQL---GHGSLEAE-------------LEPRLLEALQ 211

  Fly    97 TLGLKICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLE-- 159
              ||::.:||.|...:|.::.:.:|:..|.|   |...:|....|...        :|..|.|  
  Rat   212 --GLRMAEVAAGGWHSVCVSETGDIYIWGWN---ESGQLALPTRSGTE--------KKTVREEAT 263

  Fly   160 EFDDYLSKNEET--------DNFMTVQ------------------AGKEHFAVLTTTGRLIGCGS 198
            |.:|...:.||.        .:|:.:|                  .|..|.||:|.||.|...|.
  Rat   264 ELNDDGLRGEEAALADVGAPAHFIAIQPFPALLDLPLGSDAVKASCGSRHTAVVTRTGELYTWGW 328

  Fly   199 NAQLQLGELEADYDGHP------VEIRLDAPVQQFTCGPESTLV 236
            ....|||..::.....|      ||.:|:  |:..||||.:|.|
  Rat   329 GKYGQLGHKDSTSSDQPCRVEYFVERQLE--VRAVTCGPWNTYV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 62/239 (26%)
Rccd1XP_006229517.1 RCC1_2 163..192 CDD:290274 9/28 (32%)
RCC1 180..228 CDD:278826 19/65 (29%)
RCC1_2 218..244 CDD:290274 8/28 (29%)
RCC1_2 305..333 CDD:290274 9/27 (33%)
RCC1 321..368 CDD:278826 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.