DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Rccd1

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_775621.2 Gene:Rccd1 / 269955 MGIID:2444156 Length:377 Species:Mus musculus


Alignment Length:253 Identity:60/253 - (23%)
Similarity:94/253 - (37%) Gaps:71/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YIKNDP-----------VKRLISGPNQSAVICESGRLFVWGENHYGQLGIGGHGGASGKKGGGSH 79
            |:..:|           |::|..|.....::|.:|::|.||...:|||   |||....:      
Mouse   146 YVTPEPPFCQPLAPELRVRQLELGAEHVLLLCAAGQVFSWGAGRHGQL---GHGTLEAE------ 201

  Fly    80 NGNGDIVTKPTCVKALKTLGLKICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQV 144
                   .:|..::||:  ||::..||.|...:|.|:.:.:|:..|.|...:.....:..|..:.
Mouse   202 -------LEPRLLEALQ--GLRMAKVAAGGWHSVCLSETGDIYIWGWNESGQLALPTRSGTENKA 257

  Fly   145 DQQPCAIIRKPFRLEE-----------------FDDYLSKNEETDNFMTVQAGKEHFAVLTTTGR 192
            :::....:.:....||                 |...|.....:|..| ...|..|.||:|.||.
Mouse   258 EREEATELNEDGLKEELAVADAGAPAHFIAIQPFPALLDLPLGSDAVM-ASCGSRHTAVVTRTGE 321

  Fly   193 LI--GCGSNAQLQLGELEADYDGHPVEIRLDAP------------VQQFTCGPESTLV 236
            |.  |.|...||          ||.....||.|            |:..||||.:|.|
Mouse   322 LYTWGWGKYGQL----------GHKDSTSLDRPCCVEYFVERQLEVRAVTCGPWNTYV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 60/253 (24%)
Rccd1NP_775621.2 Interaction with KDM8. /evidence=ECO:0000250|UniProtKB:A6NED2 1..172 5/25 (20%)
ATS1 <159..341 CDD:227511 48/210 (23%)
RCC1 2 179..230 20/68 (29%)
RCC1 3 232..289 6/56 (11%)
RCC1 4 319..372 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.