powered by:
Protein Alignment CG33288 and K11D2.1
DIOPT Version :9
Sequence 1: | NP_996136.2 |
Gene: | CG33288 / 2768968 |
FlyBaseID: | FBgn0053288 |
Length: | 1115 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001368497.1 |
Gene: | K11D2.1 / 187290 |
WormBaseID: | WBGene00010768 |
Length: | 278 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 29/68 - (42%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 SGAIFTLGKSHLAENTQSYFYIKNDPV----------KRLISGPNQSAVICESGRLFVWGENHYG 60
:|.:|::|.....|.........::|| |::..|...:..:.|.|..:.||.|.||
Worm 149 TGNLFSMGTGTRGELGVGLIRRVDEPVHIEQLVGIRIKKVACGGWHTVALTEGGDAYTWGWNRYG 213
Fly 61 QLG 63
|||
Worm 214 QLG 216
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33288 | NP_996136.2 |
ATS1 |
5..>260 |
CDD:227511 |
18/68 (26%) |
K11D2.1 | NP_001368497.1 |
ATS1 |
<118..>259 |
CDD:227511 |
18/68 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5184 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.