DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and W09G3.7

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001021671.2 Gene:W09G3.7 / 173245 WormBaseID:WBGene00012370 Length:404 Species:Caenorhabditis elegans


Alignment Length:263 Identity:60/263 - (22%)
Similarity:94/263 - (35%) Gaps:83/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IPASGAIFTLGKSHLAENTQSYFYIKNDPVK----------RLISGPNQSAVIC-ESGRLFVWGE 56
            :.:|||:|:.|.:...:.....:.|:.:|.|          :.:||...:.:.| |:|.:|:||:
 Worm   195 VDSSGAVFSFGLNEDGQCGNEAYGIQWEPAKVRGDVEGSKIQKVSGSTDTLLACSENGEIFIWGQ 259

  Fly    57 NHYGQLGIGGHGGASGKKGGGSHNGNGDIVTKPTCVKALKTLGLKICDVAFGNHWAVMLTHSNEI 121
            ..|||..                 |..|.:...|......:||..||         |..|.|:.:
 Worm   260 TEYGQAA-----------------GATDEIQLNTSRHVANSLGPIIC---------VDSTQSSVV 298

  Fly   122 FFTGR-NIF----------PEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDDYLSKNEETDNFM 175
            ....| |:|          ||...:.   |..|:||        |.    ||..:        ..
 Worm   299 ARNSRGNVFVWGVGVLGMGPEAESLK---TPTQMDQ--------PL----FDGKM--------VT 340

  Fly   176 TVQAGKEHFAVLTTTGRLIGCGSNAQLQLGELEADYDGH------PVEIRLDAPVQQFTCGPEST 234
            :|.||....:.:...|||...|.|....||.      ||      |.::.|...|::...||:.:
 Worm   341 SVSAGNSCMSAINEDGRLFIWGENRYSSLGL------GHQKRQLFPYQLFLPGDVRKAALGPDHS 399

  Fly   235 LVL 237
            |.|
 Worm   400 LFL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 60/261 (23%)
W09G3.7NP_001021671.2 ATS1 <108..347 CDD:227511 44/200 (22%)
RCC1 142..195 CDD:278826 60/263 (23%)
RCC1 198..239 CDD:278826 8/40 (20%)
RCC1 355..402 CDD:278826 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.