DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33288 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_996136.2 Gene:CG33288 / 2768968 FlyBaseID:FBgn0053288 Length:1115 Species:Drosophila melanogaster
Sequence 2:NP_001164165.1 Gene:Rcbtb2 / 105670 MGIID:1917200 Length:551 Species:Mus musculus


Alignment Length:315 Identity:74/315 - (23%)
Similarity:116/315 - (36%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SGPNQSAVICESGRLFVWGENHYGQLGIG--GHGGASGKKGGGSHNGNGDIVTKPTCVKALKTLG 99
            |||: ..:....|.:|.||.|.|.|||.|  .||                :|   .|..:.....
Mouse   107 SGPH-IVLATTDGEVFTWGHNAYSQLGNGTTNHG----------------LV---PCHISTNLSN 151

  Fly   100 LKICDVAFGNHWAVMLTHSNEIFFTGRNIFPEDTHVAQHFTSAQVDQQPCAIIRKPFRLEEFDDY 164
            .::.:||.|::.:::||...|:|..|.|            .|.||.....|....|.|:..    
Mouse   152 KQVIEVACGSYHSLVLTSDGEVFAWGYN------------NSGQVGSGSTANQPIPRRVTG---- 200

  Fly   165 LSKNEETDNFMTVQAGKEHFAVLTTTGRLI--GCGSNAQLQLGELEADYDGHPVEIRLDA----P 223
            ..:|:..   |.:..|:.....:..||.:.  |...|.||.||    .....|...|:.|    .
Mouse   201 CLQNKVV---MNIACGQMCSMAVVDTGEVYVWGYNGNGQLGLG----SSGNQPTPCRVAALQGIR 258

  Fly   224 VQQFTCGPESTLVLTATGNLFL----------TGHLNEFVFPRFTELQKNLPPTEAIIFM---HI 275
            ||:..||...|||||..|.::.          ||:.:...:|....::|     :.||.:   |.
Mouse   259 VQRVACGYAHTLVLTDEGQIYAWGANSYGQLGTGNKSNQSYPTPVVVEK-----DRIIEIAACHS 318

  Fly   276 SKTSEVYIVTNAGSIYRSFESLRNKSLVFQRFYDYDCEEN--------GPIWKLL 322
            :.||..  .|..|.:| .:...|.:|::......:.|.::        ...|:||
Mouse   319 AHTSAA--KTQGGHVY-MWGQCRGQSVILPHHTHFCCTDDVFACFATPAVTWRLL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33288NP_996136.2 ATS1 5..>260 CDD:227511 59/240 (25%)
Rcbtb2NP_001164165.1 RCC1 1. /evidence=ECO:0000255 64..115 3/8 (38%)
ATS1 <107..335 CDD:227511 68/278 (24%)
RCC1 2. /evidence=ECO:0000255 117..169 18/70 (26%)
RCC1 3. /evidence=ECO:0000255 171..222 13/69 (19%)
RCC1 4. /evidence=ECO:0000255 223..274 19/54 (35%)
RCC1 5. /evidence=ECO:0000255 276..326 10/56 (18%)
RCC1 6. /evidence=ECO:0000255 328..382 8/44 (18%)
BTB_POZ_RCBTB2_CHC1L 374..490 CDD:349663
BACK_RCBTB2 487..551 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.