DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnS and AILP1

DIOPT Version :9

Sequence 1:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_197415.1 Gene:AILP1 / 832034 AraportID:AT5G19140 Length:234 Species:Arabidopsis thaliana


Alignment Length:241 Identity:52/241 - (21%)
Similarity:94/241 - (39%) Gaps:41/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGIF--AIFSRDGEPIPTQILHGSK-HSLRELAYRQSGKHRHRGPDSTGVYVNSLEGVAMIHE- 61
            |.|||  ||.|    |....:..||: .|.:........:...:.|.:..|.|.....:|..|. 
plant     1 MLGIFSGAIVS----PPEELVAAGSRTPSPKTTGSTLVNRFVEKNPSAVSVQVGDYVQLAYSHHN 61

  Fly    62 ----RLRIIGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPMSDCHVILELYQD 122
                |.|..|.:  |:.|....|:            |:....:.::.|.....::..:::|.|:.
plant    62 ESPLRPRSFGAK--DEIFCLFQGS------------LDNLGSLKQQYGLAKNANEVLLVIEAYKT 112

  Fly   123 Y-------GKDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKCLVD 180
            .       ...::.:::|.|||.::|:.|..:.:|.|..|.:|:|.|..|.|.:..|.::..|..
plant   113 LRDRAPYPANHVVAHLSGDFAFVVFDKSTSTLFVASDQVGKVPLYWGITADGYVAFADDVDLLKG 177

  Fly   181 TCSK-VETFTPG---EARFGKVGDFKTCWQFQQSWIKEVPTQTCEL 222
            .|.| :.:|..|   ....|.:..|:.    .::.|..||....|:
plant   178 ACGKSLASFPQGCYYSTALGGLRSFEN----PKNKITAVPANEGEI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnSNP_996132.1 asnB 1..554 CDD:236513 52/241 (22%)
AsnB 2..>182 CDD:238364 41/194 (21%)
Asn_synthase 225..528 CDD:279122
AILP1NP_197415.1 Wali7 2..226 CDD:238891 51/240 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.