DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnS and AT4G27450

DIOPT Version :9

Sequence 1:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_567775.1 Gene:AT4G27450 / 828854 AraportID:AT4G27450 Length:250 Species:Arabidopsis thaliana


Alignment Length:198 Identity:45/198 - (22%)
Similarity:81/198 - (40%) Gaps:32/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IHERLRIIGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPMSDCHVILELY--- 120
            ||:||           |...| ::..:..|.:.|..:|:    |:.|.....::...::|.|   
plant    68 IHQRL-----------FCGFD-DIYCLFFGSLNNLCQLN----KQYGLTKTTNEAMFVIEAYRTL 116

  Fly   121 QDYG--------KDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKC 177
            :|.|        |||    .|.|:|.:||.|...|..|....|.:.:|.|..|.|::.::.::..
plant   117 RDRGPYPADQVVKDL----DGSFSFVVYDSKAGSVFTALGSDGGVKLYWGIAADGSVVISDDLDV 177

  Fly   178 LVDTCSKVETFTPGEARFGKVGDFKTCWQFQQSWIKEVPTQTCELSLLRANLEFAVRSHLQCDVQ 242
            :.:.|:|.....|....|...|...: ::...:.||.:|....|..|..||.:..|.:.:....:
plant   178 IKEGCAKSFAPFPTGCMFHSEGGLMS-FEHPMNKIKAMPRVDSEGVLCGANFKVDVYNRVNSIPR 241

  Fly   243 MGA 245
            .|:
plant   242 RGS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnSNP_996132.1 asnB 1..554 CDD:236513 45/198 (23%)
AsnB 2..>182 CDD:238364 31/133 (23%)
Asn_synthase 225..528 CDD:279122 4/21 (19%)
AT4G27450NP_567775.1 Wali7 2..230 CDD:238891 43/182 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.