DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnS and AT3G22850

DIOPT Version :9

Sequence 1:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_188925.1 Gene:AT3G22850 / 821857 AraportID:AT3G22850 Length:248 Species:Arabidopsis thaliana


Alignment Length:174 Identity:43/174 - (24%)
Similarity:77/174 - (44%) Gaps:29/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGVEMGDQPFVS---EDGNLIL------------VANGEIYNYLELSAEIAKKR-GSYNPMSDCH 114
            :.:.:|...|::   |..|.:|            :..|.|.|     ..|.|:: |.....::..
plant    44 VTINLGSSGFIACSLEKQNPLLPRLFAVVDDMFCIFQGHIEN-----VPILKQQYGLTKTATEVT 103

  Fly   115 VILELY---QDYG----KDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVA 172
            :::|.|   :|.|    :.:::...|.|.|.|||..|:.|.||.|..|.:|:|.|.||.|:|.|:
plant   104 IVIEAYRTLRDRGPYSAEQVVRDFQGKFGFMLYDCSTQNVFLAGDVDGSVPLYWGTDAEGHLVVS 168

  Fly   173 SEMKCLVDTCSKVETFTPGEARFGKVGDFKTCWQFQQSWIKEVP 216
            .:::.:...|.|.....|....|...|..:: ::...:.:|.||
plant   169 DDVETVKKGCGKSFAPFPKGCFFTSSGGLRS-YEHPSNELKPVP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnSNP_996132.1 asnB 1..554 CDD:236513 43/174 (25%)
AsnB 2..>182 CDD:238364 35/138 (25%)
Asn_synthase 225..528 CDD:279122
AT3G22850NP_188925.1 DUF3700 2..226 CDD:403619 43/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.