DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnS and AT3G15450

DIOPT Version :9

Sequence 1:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_566513.1 Gene:AT3G15450 / 820784 AraportID:AT3G15450 Length:253 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:64/168 - (38%) Gaps:44/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LAY-RQSGKHRHR---GPDSTGVY---VNSLEGVAMIHERLRIIGVEMGDQPFVSEDGNLILVAN 87
            ||| ||....|.|   |.|  |:|   :..|..:..::.:..:.|....:..||.          
plant    57 LAYARQETSLRQRLFCGLD--GIYCMFLGRLNNLCTLNRQYGLSGKNSNEAMFVI---------- 109

  Fly    88 GEIYNYLELSAEIAKKRGSYNPMSDCHVILELYQDYGKDLLQYITGMFAFALYDRKTKEVLLARD 152
             |.|..|       :.||.|.               ...:|:.:.|.|||.:||.:|..|..|..
plant   110 -EAYRTL-------RDRGPYP---------------ADQVLRGLEGSFAFVVYDTQTSSVFSALS 151

  Fly   153 PFGIIPMYVGEDASGNLWVASEMKCLVDTCSKVETFTP 190
            ..|...:|.|....|::.::.:::.:...|:|  :|.|
plant   152 SDGGESLYWGISGDGSVVMSDDIQIIKQGCAK--SFAP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnSNP_996132.1 asnB 1..554 CDD:236513 39/168 (23%)
AsnB 2..>182 CDD:238364 35/158 (22%)
Asn_synthase 225..528 CDD:279122
AT3G15450NP_566513.1 DUF3700 2..229 CDD:403619 39/168 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.