DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnS and ASNSD1

DIOPT Version :9

Sequence 1:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001340426.1 Gene:ASNSD1 / 54529 HGNCID:24910 Length:643 Species:Homo sapiens


Alignment Length:641 Identity:122/641 - (19%)
Similarity:211/641 - (32%) Gaps:245/641 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGIFAIFSRDGEPIPTQILHGSKHSLRELAYRQSGKHRHRGPDSTGVYVNS------LEGVAMI 59
            ||||....:...|       |.|:....:|.|..    :.|||:|:...:.|      |....::
Human     1 MCGICCSVNFSAE-------HFSQDLKEDLLYNL----KQRGPNSSKQLLKSDVNYQCLFSAHVL 54

  Fly    60 HERLRIIGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPMSDC---HVILELYQ 121
            |.|    || :..||...|.||:.| .||||::.:::.||....:..:|.:|.|   ..||.|:.
Human    55 HLR----GV-LTTQPVEDERGNVFL-WNGEIFSGIKVEAEENDTQILFNYLSSCKNESEILSLFS 113

  Fly   122 DYGKDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMY--------------VGEDASG--NLW 170
            :        :.|.::|..|...:..:...||.||...:.              ||...||  |.|
Human   114 E--------VQGPWSFIYYQASSHYLWFGRDFFGRRSLLWHFSNLGKSFCLSSVGTQTSGLANQW 170

  Fly   171 ----------------------------------------------------------VASEMKC 177
                                                                      ||:|.|.
Human   171 QEVPASGLFRIDLKSTVISGCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKL 235

  Fly   178 LVDT-----------------CSKVETFTPGEARFGKVGDFKTCWQFQQSWI-----KEVPTQTC 220
            .::.                 ||.:....|..             :..|.::     |||..|..
Human   236 YLEKPVVPLNMMLPQAALETHCSNISNVPPTR-------------EILQVFLTDVHMKEVIQQFI 287

  Fly   221 ELSLLRANLEFAVRSHLQC------------------DVQMGALLSGGVDSSLIASIATKIMRER 267
            ::      |..||:..:.|                  ...:..|.|||:||.:||::|.:.:...
Human   288 DV------LSVAVKKRVLCLPRDENLTANEVLKTCDRKANVAILFSGGIDSMVIATLADRHIPLD 346

  Fly   268 DPNFRL--------KTFSVGLR----------DAPDFQAARSV-AKYIDSDHKEI---------- 303
            :|...|        ||......          :.|..:.::.| |...||.:|.:          
Human   347 EPIDLLNVAFIAEEKTMPTTFNREGNKQKNKCEIPSEEFSKDVAAAAADSPNKHVSVPDRITGRA 411

  Fly   304 ---------------IFEIDEALDGIRDI----IYH----LETYDVTTVRCS-------LPMLLL 338
                           ..||:.:::.::.:    |.|    |:|....::.|:       :..|:.
Human   412 GLKELQAVSPSRIWNFVEINVSMEELQKLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVA 476

  Fly   339 ARYIKS--TGIKMILSGEGADEIFGGYLYFH---KAPSYNDFHEELVKRVRQLHLSDCLRANKVA 398
            ...:||  :..|::|:|.||||...||....   ::......::|::..:.::...:..|.::|.
Human   477 QEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKEIMMELGRISSRNLGRDDRVI 541

  Fly   399 MAKGVELRVPFLDTGFVNHVMQIRPEDK----IPGPLNKFGEVQQKRLEKYVLRAA 450
            ...|.|.|.||||...|:.:..:...:|    :|..:.          ||.:||.|
Human   542 GDHGKEARFPFLDENVVSFLNSLPIWEKANLTLPRGIG----------EKLLLRLA 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnSNP_996132.1 asnB 1..554 CDD:236513 122/641 (19%)
AsnB 2..>182 CDD:238364 53/279 (19%)
Asn_synthase 225..528 CDD:279122 60/312 (19%)
ASNSD1NP_001340426.1 Gn_AT_II_novel 1..179 CDD:239735 50/202 (25%)
Asn_Synthase_B_C 322..607 CDD:238949 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0367
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.