DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or98a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:443 Identity:92/443 - (20%)
Similarity:163/443 - (36%) Gaps:128/443 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFMRYPD--LVCQAAQLPRYTWNGRRSLEVKRNLAKRIIF-WLGAVNLVYHNIGCVMYGYFGDGR 66
            |..||.:  :.|..       |:...:.::...:...:|| |..    ||..|| ::..:..|..
  Fly    19 DSFRYFEYGMFCMG-------WHTPATHKIIYYITSCLIFAWCA----VYLPIG-IIISFKTDIN 71

  Fly    67 TKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHF------ENLLNEFEELFQLIKHR---- 121
            |..|    .||.:|..:. |..||.  .:|:|....:.      :.||:|.::....:|.|    
  Fly    72 TFTP----NELLTVMQLF-FNSVGM--PFKVLFFNLYISGFYKAKKLLSEMDKRCTTLKERVEVH 129

  Fly   122 --------AYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTW 178
                    ||.|  ||..||.:..:||:                        |..|..::     
  Fly   130 QGVVRCNKAYLI--YQFIYTAYTISTFL------------------------SAALSGKL----- 163

  Fly   179 YPWQV-------QGSIPGFFAA----VACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQ 232
             ||::       :.|...|:.|    .|..:|:....:..:::..    .:|:.|.:|...|..:
  Fly   164 -PWRIYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPL----LYGLILRVHLKLLRLR 223

  Fly   233 LETI-------DARNPHAKDQLKYLIVYHTKLLNLA----DRVNRSFNFTFL---ISLSVSMISN 283
            :|::       ||.|  .:|.:| .|..|..:::.|    ..|.|:....||   |.|.:|||:.
  Fly   224 VESLCTDSGKSDAEN--EQDLIK-CIKDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINL 285

  Fly   284 CFLAFSMTMFDFGTSL---KHLLGLLLFITYNFSMC------RSGTHLILTSGKVLPAAFYNNWY 339
            .|.|      |..|.|   .::.||::   ..|..|      :....|:::      |.|::||.
  Fly   286 LFFA------DIWTGLATVAYINGLMV---QTFPFCFVCDLLKKDCELLVS------AIFHSNWI 335

  Fly   340 EGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392
            .....|:..|...:..|.|...:....:.|:|..:.:...|.::.:.|.|..|
  Fly   336 NSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 74/360 (21%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 75/365 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.