DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or94b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:372 Identity:72/372 - (19%)
Similarity:133/372 - (35%) Gaps:78/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IFWLGAV-NLVYHNIGCVMYGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHF 104
            :.|..|: :..:...|.|:|            ..:.|||.|..:        ||:|    .:.| 
  Fly    56 LMWYEAITSSDFEEAGQVLY------------MSITELALVTKL--------LNIW----YRRH- 95

  Fly   105 ENLLNEFEELFQLIKH-RAYRIHHYQE-----KYTRHIRNTFIFHTSAVVYYNSLPILLM--IRE 161
                 |...|...::| .|:.:.:.:|     :..|:.:..|.::     .:.||.:.:|  |..
  Fly    96 -----EAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWY-----IWGSLFVAVMGYISV 150

  Fly   162 HFSNSQQL--GY------RIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFF 218
            .|....:|  ||      |.:...:|.|       |:  .|......|.:|:        |::..
  Fly   151 FFQEDYELPFGYYVPFEWRTRERYFYAW-------GY--NVVAMTLCCLSNI--------LLDTL 198

  Fly   219 GIQLEIHFDGLAR----QLETI-DARNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSV 278
            |.....|...|.|    :||.: :|....|:.:|:.:...|||:..|........:...|..:..
  Fly   199 GCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVF 263

  Fly   279 SMISNCFLAFSMTMFDF----GTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWY 339
            |....||.|:.:....|    |..:..:..:.:.|...|..|..|..|...:..:..:.|..||.
  Fly   264 SAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWL 328

  Fly   340 EGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMF 386
            |..:..|::|...|....:|...:......:.:..::.|:..:|..|
  Fly   329 EYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 65/333 (20%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 68/357 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.