DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or94a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:414 Identity:78/414 - (18%)
Similarity:150/414 - (36%) Gaps:92/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVCQAAQL-PRYTWNGRRSLE------VKRN----LAKRIIF------WLGA-VNLVYHNIGCVM 58
            |:.|..|| ..:.|:.:...|      ||||    |...|.|      ||.| ::......|.|:
  Fly    13 LILQVMQLFGLWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVL 77

  Fly    59 YGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKHRA- 122
            |                  .|:..|.  .:|..|::|       |:.   .|...|...::|.. 
  Fly    78 Y------------------MSITEMA--LVVKILSIW-------HYR---TEAWRLMYELQHAPD 112

  Fly   123 YRIHHYQE--------KYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWY 179
            |::|:.:|        ::.:.....:|..:..|||.....:|.:          .||.:....:.
  Fly   113 YQLHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFL----------EGYELPFAYYV 167

  Fly   180 PWQVQGSIPGFFA---AVACQIFSCQTNM------CVNMF-IQFLINFFGIQLEIHFDGLARQLE 234
            |::.|.....:||   .:|....:|.:|:      |..:| |..|....|::|.          |
  Fly   168 PFEWQNERRYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRLR----------E 222

  Fly   235 TIDARNPHA-KDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTS 298
            |.:.:|... ..||:.:.:.|.::.:|.....|..:...|..:.:|.:..||..:.:.......:
  Fly   223 TKNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDN 287

  Fly   299 LKHLLGLLLFITYN----FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKP 359
            ....:.:|.|::..    :..|..|..:.:.:.::....::.||.|.....|::|...|....||
  Fly   288 PGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKP 352

  Fly   360 YMWKTYKLAPVSITTYMATLKFSY 383
            ...:......|.:..::.|:..:|
  Fly   353 VTIRAGNFFAVGLPIFVKTINNAY 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 58/332 (17%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 61/356 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.