DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or92a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:397 Identity:92/397 - (23%)
Similarity:174/397 - (43%) Gaps:64/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPIAY----------LAELASVAS 82
            |...|.|....|....||.:|...:.:|              .|||          |.|..:||.
  Fly    39 RDPNVIRRYLLRFYLVLGFLNFNAYVVG--------------EIAYFIVHIMSTTTLLEATAVAP 89

  Fly    83 MLGFTIVGTLNLWKMLSLKTHFENLLNEFEELF--QLIKHRAYRIHHYQEKYTRHIRNTF----I 141
            .:||:.:.....:.:...:.....||::.:|:|  .|...|.|.:..|: |:...:...|    :
  Fly    90 CIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEAQRKYNVSFYR-KHMNRVMTLFTILCM 153

  Fly   142 FHTSAVVYY----NSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIP----GFFAAVACQI 198
            .:||:..:|    :::...||..|.|  .:..|:.|    .:|:..:..:.    .::....|..
  Fly   154 TYTSSFSFYPAIKSTIKYYLMGSEIF--ERNYGFHI----LFPYDAETDLTVYWFSYWGLAHCAY 212

  Fly   199 FSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKY---LIVYHTKLLNL 260
            .:..:.:||::.:...|.    ||.:||:.:|..||..:..:...::.:||   |:|||.:.|:|
  Fly   213 VAGVSYVCVDLLLIATIT----QLTMHFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARALDL 273

  Fly   261 ADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYN------FSMCRSG 319
            ::.||..|:|..|.:...:.:..||..|.:|    .::::.:  :|.||.::      |.:|..|
  Fly   274 SEEVNNIFSFLILWNFIAASLVICFAGFQIT----ASNVEDI--VLYFIFFSASLVQVFVVCYYG 332

  Fly   320 THLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQ 384
            ..:|.:|.::..:||..||......|:|:|..::.|:.||...:.....|:|..|:|..:..|||
  Fly   333 DEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQ 397

  Fly   385 MFTCVRS 391
            .|..:|:
  Fly   398 FFALLRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 76/331 (23%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 76/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.