DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or88a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:422 Identity:104/422 - (24%)
Similarity:177/422 - (41%) Gaps:64/422 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QLEDFMRYPDLVCQAAQLPRYTWNGRRSLEVKRNLAKRIIFWLGA-VNLVYHNIGC---VMYGYF 62
            ::|:|:| |.:..:.||:..:.|. |..::.....|..:.|.|.| :|:::  .||   .:.|:|
  Fly    11 RMEEFLR-PQMFQEVAQMVHFQWR-RNPVDNSMVNASMVPFCLSAFLNVLF--FGCNGWDIIGHF 71

  Fly    63 --GDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLK----THFENLLN-----EFEELFQ 116
              |....::|     .:.|:.  :.|:|.|.     ||.||    ..|.|.|:     :......
  Fly    72 WLGHPANQNP-----PVLSIT--IYFSIRGL-----MLYLKRKEIVEFVNDLDRECPRDLVSQLD 124

  Fly   117 LIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREH-------FSNSQQLGYRIQ 174
            :.....||  ::.::| |.||   |:.......:..:|:.|.:..|       ..:.|.||    
  Fly   125 MQMDETYR--NFWQRY-RFIR---IYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLG---- 179

  Fly   175 SNTWYPWQVQGSIPGFFAAVACQIFSCQTNMC-VNMFIQF--LINFFGIQLEIHFDGLARQLETI 236
              .|.|..|:.. |.|:..|......|.|  | |:.|:.|  |.|.....|.:|...||||...|
  Fly   180 --GWLPCGVRKD-PNFYLLVWSFDLMCTT--CGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAI 239

  Fly   237 DARNPHAKDQLKY-----LIVYHTKLLN-LADRVNRSFNFTFLISLSVSMISNCFLAFSMT-MFD 294
            |.|. ...|:.::     |:|...:||| |..:.|..|...||:|..|...|.||..|.:: ..|
  Fly   240 DPRQ-SLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSD 303

  Fly   295 FGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKP 359
            .....:::|..|:.:.:.|.:|..||.|...|..:..:.....||.|...||:..|:......:.
  Fly   304 VLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRT 368

  Fly   360 YMWKTYKLAPVSITTYMATLKFSYQMFTCVRS 391
            .....:.|..|::..:...::.:|::||.::|
  Fly   369 QQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 81/334 (24%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 82/344 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.