DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or85f

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:440 Identity:88/440 - (20%)
Similarity:179/440 - (40%) Gaps:109/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EDFMRYPDLVCQAAQLPRYTW-NGRRSLEVKRNLAKRIIFWL-GAVNLVYHNIGC--VMYGYFGD 64
            |||.|.|..|         .| .|...|.|.:..::||::|: ..:.|..|.: |  ||.....:
  Fly     9 EDFARLPTTV---------FWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGV-CVGVMVFRMVE 63

  Fly    65 GRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELF-----QLIKHRAYR 124
            .:|.|.::.:...|::.:.    |:.:...:..:..::..::|.::..||:     ..|.||.. 
  Fly    64 AKTIDNVSLIMRYATLVTY----IINSDTKFATVLQRSAIQSLNSKLAELYPKTTLDRIYHRVN- 123

  Fly   125 IHHYQEKYTRHIRNTFIFHTSAVVYYNSL------PILLMIREHFSNSQQLGYRIQSNTW----- 178
             .||..|       :|::  ..::|..|.      ||:..|..:|::          |.:     
  Fly   124 -DHYWTK-------SFVY--LVIIYIGSSIMVVIGPIITSIIAYFTH----------NVFTYMHC 168

  Fly   179 YP-----------WQVQGSIPGFFAAVACQIFSCQ----TNMCV-NMFIQFLINFFGIQLEIHFD 227
            ||           |            :...|::.:    |.|.: |:.....:.:|.:|:.:||.
  Fly   169 YPYFLYDPEKDPVW------------IYISIYALEWLHSTQMVISNIGADIWLLYFQVQINLHFR 221

  Fly   228 GLARQLETIDARNPHAKDQLKY---LIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLA-- 287
            |:.|.|........|.::..|:   ::.....|::|.:.:|..|..:.|:||..:....|.:|  
  Fly   222 GIIRSLADHKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAAVICTVAVY 286

  Fly   288 ----------FSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGD 342
                      |:..:| .|||:..:          :.:|..|..::..||:|..|.:.:::::..
  Fly   287 TLIQGPTLEGFTYVIF-IGTSVMQV----------YLVCYYGQQVLDLSGEVAHAVYNHDFHDAS 340

  Fly   343 LVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392
            :.|:|.|||:::||.:|..........:|:.|:...:..||::.|.:..:
  Fly   341 IAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 65/355 (18%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 66/360 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.