DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or85e

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:423 Identity:91/423 - (21%)
Similarity:146/423 - (34%) Gaps:143/423 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 TKDPIAYL--AELASVASMLGFTIV------GTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAY 123
            ||..:..|  .||.::...|..||:      ||: .|.:.|     ..||...|.:     :|.|
  Fly    82 TKTTLDVLPTGELQAITDALTMTIIYFFTGYGTI-YWCLRS-----RRLLAYMEHM-----NREY 135

  Fly   124 RIHHYQEKYT--------RHIRN-TFIFHTS---AVVYYNSLPILLMIREHFSNSQQLGYRIQSN 176
            | ||.....|        |..|| |.::..|   .|:.:...|::|.||           .:...
  Fly   136 R-HHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIR-----------MLPLQ 188

  Fly   177 TWYPWQVQGSIPGFFAAV-ACQIFSCQTNMCVNMFIQFLINFFGIQLEI----HFDGLARQLETI 236
            .|||:...|  ||.:.|| |.|:|.   .:.|.|...|..:.| :.|.:    .||.|...|:.:
  Fly   189 CWYPFDALG--PGTYTAVYATQLFG---QIMVGMTFGFGGSLF-VTLSLLLLGQFDVLYCSLKNL 247

  Fly   237 DARNPHAK--------------------------DQLKYLIVYHTKLLNLA------DRVNRSFN 269
            ||   |.|                          :|...|..:.|.||.|:      |:.|...|
  Fly   248 DA---HTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHN 309

  Fly   270 --------FTFLISLSVSMISNCF----------LAFSMTMFDF----GT--------SLKHLLG 304
                    ..|::..| ..:.|.|          :.|.:.:..|    ||        .|:: ||
  Fly   310 ALVECIRLHRFILHCS-QELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQY-LG 372

  Fly   305 LLLFITYNFSMC---------RSGTHLILTSGKVLPAAFYNN-WYEGDLVYRRMLLILMMRATKP 359
            |.:|....|:.|         |||.            ||:.. |::.....|:.:||.::.:.:.
  Fly   373 LTIFELLMFTYCGELLSRHSIRSGD------------AFWRGAWWKHAHFIRQDILIFLVNSRRA 425

  Fly   360 YMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392
            ......|...:.:....:.:..::...|.::.|
  Fly   426 VHVTAGKFYVMDVNRLRSVITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 87/405 (21%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 78/373 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.