DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or83c

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:380 Identity:79/380 - (20%)
Similarity:136/380 - (35%) Gaps:109/380 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SVASMLGFTIVGTLNL---WKM---LSLKTH--FENLLNEFEELFQLIKHR------AYRIHHYQ 129
            ::|:..|||:...||.   |::   .||.|.  |.. |.:|  |..|:||:      .|....|.
  Fly    46 AIANYTGFTVFTILNNGGDWRVGLKASLMTGGLFHG-LGKF--LTCLLKHQDMRRLVLYSQSIYD 107

  Fly   130 EKYTR----H----------------IRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQ 174
            |..||    |                |||.::|   |......||:.:::.:        |.|:.
  Fly   108 EYETRGDSYHRTLNSNIDRLLGIMKIIRNGYVF---AFCLMELLPLAMLMYD--------GTRVT 161

  Fly   175 SNTWYPWQVQGSIPGFFAAVACQIFSCQTNMC---------VNMFIQ-------FLINFFGIQLE 223
            :       :|..|||         ...:.|.|         |.|.:|       .|..|.|:...
  Fly   162 A-------MQYLIPG---------LPLENNYCYVVTYMIQTVTMLVQGVGFYSGDLFVFLGLTQI 210

  Fly   224 IHF------------DGLA-----RQLETIDARNPHAKDQLKYL---IVYHTKLLNLADRVNRSF 268
            :.|            |.|.     |.|..:.|....|:::.:.|   |.:|....:....:|..:
  Fly   211 LTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALY 275

  Fly   269 NFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFSM---CRSGTHLILTSGKVL 330
             :..:.:..:||.....|:|.:.:..|     |:...:.|:...:||   |..||.|.....:|.
  Fly   276 -YELIATQVLSMALAMMLSFCINLSSF-----HMPSAIFFVVSAYSMSIYCILGTILEFAYDQVY 334

  Fly   331 PAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQM 385
            .:.....|||.....|::...|:..:..|:..:...:..:|:.|.:..:|..|.:
  Fly   335 ESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 78/376 (21%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 71/353 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.