DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or83a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:483 Identity:90/483 - (18%)
Similarity:160/483 - (33%) Gaps:134/483 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QLEDFMRYPDL-------VCQAAQLP-RYTWNGRRSLEVK---RNLAKRIIFWLGAVNLVYHNIG 55
            :::|..:..||       :|.||..| .|..||...|.|.   .:|...:..:..:|::....| 
  Fly     9 RIKDDSKRRDLFVFVRQTMCIAAMYPFGYYVNGSGVLAVLVRFCDLTYELFNYFVSVHIAGLYI- 72

  Fly    56 CVMYGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFE----NLLNEFEELFQ 116
            |.:|..:|.|          :|....:.|..||:   .|| .:::|.:|.    .|||..     
  Fly    73 CTIYINYGQG----------DLDFFVNCLIQTII---YLW-TIAMKLYFRRFRPGLLNTI----- 118

  Fly   117 LIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREH---------FSNSQQLGYR 172
                    :.:..::|.......|.|.|.|..|..|   .|.|:.:         |..:..:.||
  Fly   119 --------LSNINDEYETRSAVGFSFVTMAGSYRMS---KLWIKTYVYCCYIGTIFWLALPIAYR 172

  Fly   173 IQS---NTWYPW--------------QVQGSI--PGFFAA------VACQIFSCQ--------TN 204
            .:|   ..|||:              |..|.|  ...||:      |.|.:.|.|        .|
  Fly   173 DRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKN 237

  Fly   205 MCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIVYHTKLLNLADRVNRSFN 269
            :..:.::....|...:          .||:...:.......|..|.:...|.|..|. :|..|.:
  Fly   238 VLASSYVLMGANMTEL----------NQLQAEQSAADVEPGQYAYSVEEETPLQELL-KVGSSMD 291

  Fly   270 FTFLISLS-VSMISN------------------------------CFLAFSMTMFDFGTSLKHLL 303
            |:....|| |..|.:                              |.:||..|......|...::
  Fly   292 FSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMV 356

  Fly   304 GL---LLFITYN-FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKT 364
            .|   ||.:.|. |.:|.....:...|.:...|.:.:.|.......|...:..|:.:.:.:....
  Fly   357 SLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTA 421

  Fly   365 YKLAPVSITTYMATLKFSYQMFTCVRSL 392
            .|::.:::..:..|:..::...|.::.:
  Fly   422 GKISNLNVDRFRGTITTAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 70/389 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 50/295 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.