DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or71a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:414 Identity:75/414 - (18%)
Similarity:170/414 - (41%) Gaps:99/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QAAQLPRYT-WNGRRSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPIAYLAELA 78
            ::...|.:| |.. .:|.|.......::.||.|:                  :::| |.:.|::.
  Fly    26 ESVSTPDWTNWQA-YALHVPFTFLFVLLLWLEAI------------------KSRD-IQHTADVL 70

  Fly    79 SVASMLGFTIVG--TLNLWKMLSLKTHFENLLNEFE--ELFQLIKHR---AYRIHHYQEKYTRHI 136
            .:.  |..|.:|  .:|:||...:.   :.:|:|:.  :||:|...:   .:|..|      |..
  Fly    71 LIC--LTTTALGGKVINIWKYAHVA---QGILSEWSTWDLFELRSKQEVDMWRFEH------RRF 124

  Fly   137 RNTFIFH---TSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFA------ 192
            ...|:|:   ::.|:.:      ::|:..|....:|.:.:    |.|:..|..:..::|      
  Fly   125 NRVFMFYCLCSAGVIPF------IVIQPLFDIPNRLPFWM----WTPFDWQQPVLFWYAFIYQAT 179

  Fly   193 --AVACQIFSCQTNM-CVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIVYH 254
              .:||   :|...| .||.::.       :.|.:....|.::|..:...:...:::...||..|
  Fly   180 TIPIAC---ACNVTMDAVNWYLM-------LHLSLCLRMLGQRLSKLQHDDKDLREKFLELIHLH 234

  Fly   255 TKL----LNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMF-------DFGTSLKHLLGLLLF 308
            .:|    |::...:::| .||.::   ||.:..||..:||.|.       .|...:::|:.:::.
  Fly   235 QRLKQQALSIEIFISKS-TFTQIL---VSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQ 295

  Fly   309 I----TYNFSMCRSGTHLILTSGKVLPAAFYN-NWYEGDLVYRRMLLILMMRATKPYMWKTYKLA 368
            :    .|.        :.::.|..:|..:.|| :|.:.:...||::|:.|:...:|...|.....
  Fly   296 VMLPTIYG--------NAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFF 352

  Fly   369 PVSITTYMATLKFSYQMFTCVRSL 392
            .:.:..:..|:..:|.:...:.::
  Fly   353 HIGLPLFTKTMNQAYSLLALLLNM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 64/343 (19%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 63/341 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.