DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or67c

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:394 Identity:96/394 - (24%)
Similarity:176/394 - (44%) Gaps:58/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGY--FGDGRTKDPIAYLAELA-SVASMLGFTIV 89
            ||....::|..:|..:.|.:|.....||.:::.|  ..|..|       ..|| :||..:||::|
  Fly    34 RSTNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFET-------IRLAIAVAPCIGFSLV 91

  Fly    90 GTLNLWKMLSLKTHFENLLNEFEELF--QLIKHRAYRIHHYQEKYTRHIRNTFIF----HTSAVV 148
            .......|:..|.....||::.|.:.  .|.|...|::..: ||..:.:.|.|.|    :|:...
  Fly    92 ADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDF-EKTMKRVINIFTFLCLAYTTTFS 155

  Fly   149 YYNSLPILLMIREHF----SNSQQLGYRIQSNTWYP--------------WQVQGSIPGFFAAVA 195
            :|.:  |...::.:|    :..:..|:.|    |:|              |.:...  .:.|.:|
  Fly   156 FYPA--IKASVKFNFLGYDTFDRNFGFLI----WFPFDATRNNLIYWIMYWDIAHG--AYLAGIA 212

  Fly   196 CQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYL---IVYHTKL 257
            .        :|.::.:..:|.    |:.:||:.::.:||.....:...|:.:::|   |.||.|.
  Fly   213 F--------LCADLLLVVVIT----QICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKC 265

  Fly   258 LNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHL 322
            |.|.:.||..::|:.|::..::.:..||:||.:|.......:.:.:.|:..:...|.:|..|..|
  Fly   266 LKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQVFMVCYYGDTL 330

  Fly   323 ILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFT 387
            |..|.||..||:...|::....|..||.:|:||:.||...:.....|:|:.|||..:..|||.|.
  Fly   331 IAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFA 395

  Fly   388 CVRS 391
            .:|:
  Fly   396 LLRT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 80/336 (24%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 76/325 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.