DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or59c

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:377 Identity:81/377 - (21%)
Similarity:142/377 - (37%) Gaps:66/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WLGAVNLVYHNIG-CVMYGYFGDGRTKDPIAYLAELASVASMLGFTI---VGTLNLWKMLSLKTH 103
            |||   :||..:| .:.|....|..|  |..:|..|....:.:|..|   |....:|:       
  Fly    57 WLG---IVYLPLGLSLTYVKHFDRFT--PTEFLTSLQVDINCIGNVIKSCVTYSQMWR------- 109

  Fly   104 FENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQ 168
                .....||...:..|...        |...|   ||| ..|...|.:.||.:       |..
  Fly   110 ----FRRMNELISSLDKRCVT--------TTQRR---IFH-KMVARVNLIVILFL-------STY 151

  Fly   169 LGY---RIQSNTW---YPWQV--------QGSIPGFFAAV----ACQIFSCQTNMCVNMFIQFLI 215
            ||:   .:.::.:   .|||:        :|....:.|::    ...|.:.|..|.....|.| |
  Fly   152 LGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVF-I 215

  Fly   216 NFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFT-----FLIS 275
            :.|...|.|..|.:|...:..........:|:...|..|..::..:..:....:.|     .|:.
  Fly   216 SLFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVG 280

  Fly   276 LSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYE 340
            :.:.:.:...|.|..|::   |.:.::..::...|.:|..|....|||..|..|..|.|::||..
  Fly   281 IDLGLAAISILFFPNTIW---TIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWIT 342

  Fly   341 GDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392
            .|..|:..:|..:.||.:|..:....:.|:|:.:.:|..||::.:.|.|..:
  Fly   343 ADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 69/334 (21%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 71/341 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.