DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or59b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:376 Identity:76/376 - (20%)
Similarity:140/376 - (37%) Gaps:55/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IFWL---GAVNLVYHNIGCVMYGYFGDGRTKDPIAYLAELASVASMLGFTIVGTLN---LWKMLS 99
            :||.   .|..:.|..:|.:: .|..:.:...|..:|..|....::.|.::..|:.   ||::  
  Fly    47 LFWTCVPFAFGVFYLPVGFII-SYVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRL-- 108

  Fly   100 LKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFS 164
            .||  |.||:..::.......|. |||:..      .|..:.|...:.:|..           ::
  Fly   109 RKT--EILLDSLDKRLANDSDRE-RIHNMV------ARCNYAFLIYSFIYCG-----------YA 153

  Fly   165 NSQQLGYRIQSNTWYPWQV----------QGS--IPGFFAAVACQIFSCQTNMCVNMFIQFLINF 217
            .|..|.|.:....  ||.|          .||  |...|..:.......|..:.....:.|.| .
  Fly   154 GSTFLSYALSGRP--PWSVYNPFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTI-M 215

  Fly   218 FGIQLEI---HFDGLARQLETIDARNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVS 279
            |...:|:   |...|....|..:|.|   ...|...::.|..:|...|.:....:.|..:..  :
  Fly   216 FRAHMEVLKDHVRSLRMDPERSEADN---YQDLVNCVLDHKTILKCCDMIRPMISRTIFVQF--A 275

  Fly   280 MISNCFLAFSMTMFDFGTSLKHLLGLLLFIT---YNFSMCRSGTHLILTSGKVLPAAFYNNWYEG 341
            :|.:......:.:|.|....|.:..||..||   ..|..|.:...||..:..:....|.:||.:.
  Fly   276 LIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDA 340

  Fly   342 DLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392
            :..|:..|::.|....:|.::....:.|:|:.:.:...||::.:.|.||.:
  Fly   341 EPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 66/329 (20%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 67/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.