DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or49b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:341 Identity:64/341 - (18%)
Similarity:125/341 - (36%) Gaps:74/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LNLWKMLSLKTHFENLLNEFEE---LFQLIKHRAYRIHHYQEKYTRHI------------RNTFI 141
            |.||....|:.:.  ||.:.:.   |.|.:....|.:.:..:.|...|            |....
  Fly    63 LVLWINTVLRAYL--LLADHDRYLALIQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMARGNLF 125

  Fly   142 FHTSAVVYYNSLPILLMIREHFSNSQQL---GYRIQS---------NTWYPWQVQGSIPGFFAAV 194
            |.....:.:...|:        |:|:::   |.:|..         ..||.:|:      ....:
  Fly   126 FGMLTSMGFGLYPL--------SSSERVLPFGSKIPGLNEYESPYYEMWYIFQM------LITPM 176

  Fly   195 ACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHA-------KDQLKYLIV 252
            .|.::...|::.|.:.:      |||   :....|..:|..:..::|:.       ::::...|.
  Fly   177 GCCMYIPYTSLIVGLIM------FGI---VRCKALQHRLRQVALKHPYGDRDPRELREEIIACIR 232

  Fly   253 YHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTS--------LKHLLGLLLFI 309
            |...::...|.:|......||..|.......|.|.| |.:...|||        :..:|..:|.:
  Fly   233 YQQSIIEYMDHINELTTMMFLFELMAFSALLCALLF-MLIIVSGTSQLIIVCMYINMILAQILAL 296

  Fly   310 TYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITT 374
            .:..:..|.....:.|      ||:...|:..|:..|:.:|.:||||.:|.......:.|:::..
  Fly   297 YWYANELREQNLAVAT------AAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLEL 355

  Fly   375 YMATLKFSYQMFTCVR 390
            :...|..:|..||.::
  Fly   356 FQNLLNTTYTFFTVLK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 61/332 (18%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 61/332 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.