DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or49a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:338 Identity:75/338 - (22%)
Similarity:129/338 - (38%) Gaps:63/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIR-NTFIFHTSA----VVYYN 151
            |:.:.|||.:..|...:...:.|.|| .||...::.::|:..|... |.:....|.    .|||.
  Fly    78 LHFFYMLSSQLKFITFMINRKRLLQL-SHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYF 141

  Fly   152 SLPILLM--------------------------IREHFSNSQQLGYRIQSNTWYPWQVQGSIPGF 190
            .:.::.:                          .|..|.:.:.|||.:      .:.:..:...|
  Fly   142 VMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVL------AYVIDFTYSQF 200

  Fly   191 FAAVACQIFSCQTN---MCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQ----LK 248
            ...|     |..|:   |||:.           |:.:|...||..|.:| ..:|..:.|    |.
  Fly   201 IVNV-----SLGTDLWMMCVSS-----------QISMHLGYLANMLASI-RPSPETEQQDCDFLA 248

  Fly   249 YLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNF 313
            .:|..|..::.|...||..|......:|..:....|.:|:...:..|.......:.|...:...|
  Fly   249 SIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQF 313

  Fly   314 SMCRS-GTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMA 377
            .:..| |..||..|..:..|||.:.||||.|.|::.:||||.:|.:|.......:..:|:.|:..
  Fly   314 YVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKI 378

  Fly   378 TLKFSYQMFTCVR 390
            .:..:|:.|..:|
  Fly   379 LMTITYRFFAVIR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 72/329 (22%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.