DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or47b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:403 Identity:94/403 - (23%)
Similarity:167/403 - (41%) Gaps:63/403 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVCQ-----AAQLPRYTWNGRRSLEVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPI 71
            |:||     .|.||.|.|   .:|.:..|:  ..|||...|.|               ..:|:.|
  Fly    46 LLCQYPNKKLASLPLYRW---INLFIMCNV--MTIFWTMFVAL---------------PESKNVI 90

  Fly    72 AYLAELASVASM-LGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRH 135
            ....:|..::.| |.||.:..::|     .....:.|:::||     ..:|..|.|:..|:....
  Fly    91 EMGDDLVWISGMALVFTKIFYMHL-----RCDEIDELISDFE-----YYNRELRPHNIDEEVLGW 145

  Fly   136 IRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGY-RIQSNTWYP--WQVQGSIP-GFFAAVAC 196
            .|..::..:.  :|.|...::............||. ::..::.||  |......| .|:.....
  Fly   146 QRLCYVIESG--LYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWFLYIW 208

  Fly   197 QIFSCQTNMC---------VNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIV 252
            |..:.|.|:.         ::.|:|..:|...:.:||      |:|..::..:....::...::.
  Fly   209 QSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEI------RKLGDMEVSDKRFHEEFCRVVR 267

  Fly   253 YHTKLLNLADRVNRSFNFTFLISL--SVSMIS-NCFLAFSMTMFDFGTSLKH-LLGLLLFITYNF 313
            :|..::.|..:.||:||..|...|  |.|:|| :.|...:....|...:.|. ||.|:.||..:.
  Fly   268 FHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQLSL 332

  Fly   314 SMCRSGTHLILTSGKVLPAAF-YNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMA 377
             .|.|||.:...|.:|..||| .|:|:......:|.:..:::||.||.|:......|.::.|||.
  Fly   333 -WCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYML 396

  Fly   378 TLKFSYQMFTCVR 390
            .||..|::...::
  Fly   397 VLKNCYRLLALMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 76/327 (23%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 77/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.