DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or47a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:397 Identity:78/397 - (19%)
Similarity:141/397 - (35%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IGCVMYGYFGDGRTKDPIAYLA-ELASVASMLGFTIVGTLNLWK--------------------- 96
            |..:.:..|.:.|......|.| .:.|:|::..|.:...|:.||                     
  Fly    12 IALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNVLLLADAMVALLITILGLFK 76

  Fly    97 ---MLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQE----KYTRHIRNTFIFHTSAVVYYNSLP 154
               :|.|:..|:.|:::|.   .|:.:.|.:...|.|    ...:..|...:|.|..::.:....
  Fly    77 FSMILYLRRDFKRLIDKFR---LLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNS 138

  Fly   155 ILLMIREHFSNSQQLGYRIQSNT--------WYPWQVQ-------GSIPGFFAA--VACQIFSCQ 202
            :|.::|      ..|.|.:..:.        .:||.:.       ..|...||:  |.....|..
  Fly   139 VLPLVR------MGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSFIWSAFASTGVVLPAVSLD 197

  Fly   203 TNMCVNMFIQFLINFFGI-QLE-IHFDG--LARQLETIDARNPHAKDQLKYLIVYHTKLLNLADR 263
            |..|  .|...|..||.| |.: :.|.|  |.....|::          |...:|.|. |::.:.
  Fly   198 TIFC--SFTSNLCAFFKIAQYKVVRFKGGSLKESQATLN----------KVFALYQTS-LDMCND 249

  Fly   264 VNRSFNFTFLISLSVSMISNCFLA--FSMTMFDF-GTSLKHLLGLLLFITYNFSMCRSGTHLILT 325
            :|:.:.........:|.:..|.|.  ||:|.... |......:..::...|.:..|  |.:|...
  Fly   250 LNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAYIYCYC--GENLKTE 312

  Fly   326 SGKVLPAAFYNNWYE------GDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQ 384
            |.....|.:.:.|:|      ......|.|||.||||.:.:....| ....::..:.:.::.:..
  Fly   313 SASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGY-FFEANMEAFSSIVRTAMS 376

  Fly   385 MFTCVRS 391
            ..|.:||
  Fly   377 YITMLRS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 71/367 (19%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 64/343 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.