DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or43b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:414 Identity:82/414 - (19%)
Similarity:148/414 - (35%) Gaps:138/414 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NIGCVMYGYFGDGR----------------TKDPIAYLAELASV-ASMLGFTIVGTLNLW----K 96
            |.|..:...||.||                ...||.|:..||.. ..:|..::...||.|    |
  Fly    32 NSGLNLKNDFGIGRKIWRVFSFTYNMVILPVSFPINYVIHLAEFPPELLLQSLQLCLNTWCFALK 96

  Fly    97 MLSL--KTHFENLLNE-FEELFQLIKHRAYRIHHYQEKY------TRHIRN-----TFIFHTSAV 147
            ..:|  .||...|.|: |:||               :||      .|.:|:     |.::.|..|
  Fly    97 FFTLIVYTHRLELANKHFDEL---------------DKYCVKPAEKRKVRDMVATITRLYLTFVV 146

  Fly   148 VY--YNSLPILLMIREHFSNSQQLGYRIQSNTWYP---WQVQGSIPGFFAAVACQIFSCQTNMCV 207
            ||  |.:..:|..:..|         |:..||:||   |:|..:                     
  Fly   147 VYVLYATSTLLDGLLHH---------RVPYNTYYPFINWRVDRT--------------------- 181

  Fly   208 NMFIQFLINFFGIQLEIHFDGLARQLET-----IDARNPH---AKDQLKYL-------------- 250
            .|:||..:.:|.:...|:   :|...::     :.|...|   .||::.||              
  Fly   182 QMYIQSFLEYFTVGYAIY---VATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYM 243

  Fly   251 -------IVYHTKLLNLADRVNRSFNFT----FLIS---LSVSMISNCFLAFSMTMFDFGTSLKH 301
                   |..|..:||..|.:....:.|    |:|.   |.:.||:....|...|.|        
  Fly   244 FKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRF-------- 300

  Fly   302 LLGLLLFI----TYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMW 362
              |:::::    ...|.:|.....::....::..|.|::.|:..|..|:|.::..:.:..:|..:
  Fly   301 --GIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTF 363

  Fly   363 KTYKLAPVSITTYMATLKFSYQMF 386
            ....:..:::.|.:...||::.::
  Fly   364 TAMNIFNINLATNINVAKFAFTVY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 73/372 (20%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 67/346 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.