DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or42b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:405 Identity:68/405 - (16%)
Similarity:144/405 - (35%) Gaps:90/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AKRIIFWL----GAVNLVYHN------IGCVMY---GYFGDGRTK----DPIAYLAELASVASML 84
            |.:.|.||    |.:..||..      :.|..|   |:.|...|:    .|..:|..|....:..
  Fly    27 AMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAY 91

  Fly    85 GFTIVGTLN---LWKMLSLKTHFENL------LNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTF 140
            |.::...:.   ||:::..|...:.|      :.|.|::..::....:....:...|..:..:|:
  Fly    92 GSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTY 156

  Fly   141 IFHTSAVV-------YYNSL------PILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFA 192
            :   |:|:       .||..      .:.|.:      :..|.|.:.|......|:..|.|..:.
  Fly   157 L---SSVLSGRPPWQLYNPFIDWHDGTLKLWV------ASTLEYMVMSGAVLQDQLSDSYPLIYT 212

  Fly   193 AVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETI----DARNPHAKDQLKYLIVY 253
            .:                           |..|.|.|..::..:    :.....:.::|...::.
  Fly   213 LI---------------------------LRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMD 250

  Fly   254 HTKLLN---LADRVNRSFNFT--FLISLSVSM-ISNCFLAFSMTMFDFGTSLKHLLGLLLFITYN 312
            |..:|.   :...|.:...||  .||.|.:.. :.|.|. ||    |..|.:...:.::..:...
  Fly   251 HKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFTLINVFF-FS----DIWTGIASFMFVITILLQT 310

  Fly   313 FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMA 377
            |..|.:...::.....:..|.|.:||.:....|:..||..:....:|.::....:..:|:::.::
  Fly   311 FPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNIS 375

  Fly   378 TLKFSYQMFTCVRSL 392
            ..||::.:.|..:.:
  Fly   376 VAKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 54/340 (16%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 55/345 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.