DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or33b

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:309 Identity:69/309 - (22%)
Similarity:130/309 - (42%) Gaps:44/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LNEFEELFQLIKHRAYRIH--HYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLG 170
            :.|.|.||:.:..||....  .:..:.||...| ||: .|.:|.|....|..:....|..    |
  Fly    92 IKEIEILFKELDQRALSREECEFFNQNTRREAN-FIW-KSFIVAYGLSNISAIASVLFGG----G 150

  Fly   171 YRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMF------IQFLINFFGIQLEIHFDGL 229
            :::....|:|:.||.:...|:.:|..||......:..|:.      :.|.:....::|      |
  Fly   151 HKLLYPAWFPYDVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTFCVVAGHVRL------L 209

  Fly   230 ARQLETIDARNPH-----AKDQLKYLIVYHTKLLNLADRVNRSFNFTFL-------ISLSVSMIS 282
            |.:|..| .:.|.     ...||...|..|.||:.:.:.:..:.|.:.|       :::|:::::
  Fly   210 AMRLSRI-GQGPEETIYLTGKQLIESIEDHRKLMKIVELLRSTMNISQLGQFISSGVNISITLVN 273

  Fly   283 NCFLA---FSMTMFDFGTSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLV 344
            ..|.|   |::|.:..     :.|.::|.:   |..|..||.:.:...::..|.:.:||...:..
  Fly   274 ILFFADNNFAITYYGV-----YFLSMVLEL---FPCCYYGTLISVEMNQLTYAIYSSNWMSMNRS 330

  Fly   345 YRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSLK 393
            |.|:|||.|.........|...:..:.:..:.||::.:|..||...||:
  Fly   331 YSRILLIFMQLTLAEVQIKAGGMIGIGMNAFFATVRLAYSFFTLAMSLR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 64/297 (22%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 64/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.