DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or24a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:412 Identity:81/412 - (19%)
Similarity:157/412 - (38%) Gaps:96/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EVKRNLAKRIIFWLGAVNLVYHNIGCVMYGYFGDGRTKDPIAY--------LAELASVASMLGFT 87
            |.||.:..::..:.....|.|   ||....|:|       |.|        |..|..|||.:   
  Fly    32 EQKRTVLVKLWSFFNFFILTY---GCYAEAYYG-------IHYIPINIATALDALCPVASSI--- 83

  Fly    88 IVGTLNLWKMLSLKTHFENLLNEFEEL-FQLIKHRAYRIHHYQEK-YTRHIRNTFI-----FHTS 145
                |:|.||:::..:.:.|.:..|.: |...:.::.|...|::: ||...:.||:     |.||
  Fly    84 ----LSLVKMVAIWWYQDELRSLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTS 144

  Fly   146 AVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYP-----------------WQVQGSIPGFFAA 193
            .......|...::.|.|   .:...|.......:|                 |.      |:. .
  Fly   145 TSYSVRHLIDNILRRTH---GKDWIYETPFKMMFPDLLLRLPLYPITYILVHWH------GYI-T 199

  Fly   194 VACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGL-ARQLETIDARNPHAKD-----QLKYLIV 252
            |.|.:.:      ...|:.|.:.|..:.|.:..|.. ..::|.|:.....|::     :::.|:.
  Fly   200 VVCFVGA------DGFFLGFCLYFTVLLLCLQDDVCDLLEVENIEKSPSEAEEARIVREMEKLVD 258

  Fly   253 YHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHL-----LGLLLFITYN 312
            .|.::..|.:|            ||..|:......|..:....|||:..:     ||:::::.|.
  Fly   259 RHNEVAELTER------------LSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIVYVVYT 311

  Fly   313 -------FSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPV 370
                   |..|..|:|::.....:..:.|.::||...:..::|.|:::.||.:....|....:| 
  Fly   312 CAVGVEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSP- 375

  Fly   371 SITTYMATLKFSYQMFTCVRSL 392
            |:.|..:.|:|:..:....:|:
  Fly   376 SLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 69/350 (20%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 69/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.