DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or23a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:328 Identity:68/328 - (20%)
Similarity:126/328 - (38%) Gaps:49/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LGFTIVGTLNLWK------MLSLKTHFENLLNEFEELF----QLIKHRAYRIHHYQEKYTRH-IR 137
            |..|:....||.|      .|:.....::|:.:.:...    |..:||         ..|.| :|
  Fly    67 LSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHR---------NMTEHLLR 122

  Fly   138 NTFIFH-TSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQ---- 197
            .:.:|. |.|||:     |:..:...|.....|...:    |:|:..:.|:..:..|:..|    
  Fly   123 MSKLFQITYAVVF-----IIAAVPFVFETELSLPMPM----WFPFDWKNSMVAYIGALVFQEIGY 178

  Fly   198 IFSCQTNMCVNMF---IQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIVYHTKLLN 259
            :|........:.|   :.:||:.....|.:....:....:|::..    :..|...|.....|..
  Fly   179 VFQIMQCFAADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEEN----EQDLVNCIRDQNALYR 239

  Fly   260 LADRVNRSFNFTFLISLSVSMISNCFLAFSM-----TMFDFGTSLKHLLGLLLFITYNFSMCRSG 319
            |.|......::..::...|..|:.....|.:     |::|....|..|||:.:   ..:.:|..|
  Fly   240 LLDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITV---QTYPLCYYG 301

  Fly   320 THLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQ 384
            |.:..:..::..|.|.:||.:....||..:|||..|..:..:.....|.|:.::||:|..|.:|.
  Fly   302 TMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYS 366

  Fly   385 MFT 387
            .||
  Fly   367 FFT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 65/322 (20%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 65/322 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.