DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or10a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:348 Identity:71/348 - (20%)
Similarity:134/348 - (38%) Gaps:62/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GFTIVGTLNLWKMLSLKTHFENLLNE-----FEELFQLIKHRAYRIHHYQEKYTRHIRNTFI--- 141
            |.:.|..|.::.||..:.....:.|.     |:..::..:.|..|:.|    .....|..|.   
  Fly    82 GTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKH----SAMAARINFWPLS 142

  Fly   142 --FHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQSNTWY-PW-----QVQGSIPGF-----FAA 193
              |.|...  ||..|||:.:..:..|      |.:...|: |:     :|..:.|.|     |.|
  Fly   143 AGFFTCTT--YNLKPILIAMILYLQN------RYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIA 199

  Fly   194 VACQIFSCQTNMCVNMFIQF------LINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIV 252
            ....:.......|...:.:|      |......::|..|......||....:....:.:::.:|:
  Fly   200 YTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPVQLYILEQKMRSVII 264

  Fly   253 YHTKLLNLADRVNRSFNFTF-LISLSVSMISNCFLAFSM----TMFDFGTSLKHLLGLLLFITYN 312
            .|..:::|    .|.|...: :|:|:..:.:...:.|||    |:.:.|      ||.:|::.|.
  Fly   265 RHNAIIDL----TRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNG------LGAMLYVAYT 319

  Fly   313 FS-------MCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPV 370
            .:       .|..||.:..:|..:..|.|...|.......||::.:|::|:.:|........:| 
  Fly   320 VAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP- 383

  Fly   371 SITTYMATLKFSYQMFTCVRSLK 393
            |:.|:.|.|:.|..:...|:|.:
  Fly   384 SLATFAAILQTSGSIIALVKSFQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 68/336 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 68/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.