DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or65a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:387 Identity:74/387 - (19%)
Similarity:144/387 - (37%) Gaps:76/387 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RIIFWLGAVNL-VYHNIGCVMYGY---FGD----GRTKDPIAYLAELASVASMLGFTIVGTLNLW 95
            ||:.|...|:: :...:..:.||.   .||    ||   .:.::..:..:...|.|         
  Fly    62 RIVAWQYFVSIQLATALASLFYGISESIGDIVNLGR---DLVFIITIIFICFRLVF--------- 114

  Fly    96 KMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEK--YTRHIRNT----FIFHTSAVVYYNSLP 154
                    |.....|.:.:...::.    |:|:..|  .|:.::.|    |:...:.::.:.|..
  Fly   115 --------FAQYAGELDVIIDALED----IYHWSIKGPATKEVQETKRLHFLLFMALIITWFSFL 167

  Fly   155 ILLMI----REHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQF-L 214
            ||.|:    ...:..||.|.:.:.      |..|...|.........||..|:...:...|.. :
  Fly   168 ILFMLIKISTPFWIESQTLPFHVS------WPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGV 226

  Fly   215 INFFGIQLEIHFDGLARQLETIDARNPH----AKDQLKY-----LIVYHTKLLNLADRVNRSFNF 270
            :...|:.|........|.| .|:.||..    ..:.:.|     :..:|.:::.|.||.|..||.
  Fly   227 VENMGVSLFFELTSALRVL-CIELRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNG 290

  Fly   271 TFLISLSVSMISNCFLAFSMTMFDF-------GTSLKHLLGLLLFITYNFSMCRSGTHLILTSGK 328
            .|::.:.::     ||..|:::|:.       ..::::::.:|:.:.:.....:.|......|.:
  Fly   291 AFIMQMLIN-----FLLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQ 350

  Fly   329 VLPAAFYNNWYE---GDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFT 387
            |..|.:  ..|:   |.....|.....:.||.||.:.|.....|.::..||..||..|.:.|
  Fly   351 VALAVY--EAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILT 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 62/338 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 54/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.