DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or69a and Or46a

DIOPT Version :9

Sequence 1:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:199 Identity:39/199 - (19%)
Similarity:84/199 - (42%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 CQIFSCQTNMCVNMFIQFLINFFGIQLE---IHFDGLARQLETIDARNPHAKDQLKYLIVYHTKL 257
            |.:.:|..|:..:.....|:.|..:||:   :..:.|...:|..|  |.....:|:....|:.::
  Fly   179 CLLPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIEPQD--NEKIAMELRECAAYYNRI 241

  Fly   258 LNLADRVNRSFNFTFLISLSVS---MISNCFLAFSMTMF--DFGTSLKHLLGLLLFITYNFSMCR 317
            :...|.|.........:.|..|   ::||.:...:|::.  |....||..:..|:.:...|.:|.
  Fly   242 VRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICY 306

  Fly   318 SGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFS 382
            :...:.:.|.::..:.:.:.|...:...||::|::|.|...|.:          ::|:..|..||
  Fly   307 ASNEVTVQSSRLCHSIYSSQWTGWNRANRRIVLLMMQRFNSPML----------LSTFNPTFAFS 361

  Fly   383 YQMF 386
            .:.|
  Fly   362 LEAF 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 37/194 (19%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.