DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7369 and CG5522

DIOPT Version :9

Sequence 1:NP_649415.2 Gene:CG7369 / 2768961 FlyBaseID:FBgn0037188 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster


Alignment Length:375 Identity:85/375 - (22%)
Similarity:134/375 - (35%) Gaps:126/375 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 ASGTSNSSSSGHTSSASTSNSISTTPQPDDVFGIMDMCPSC------------------AH---- 388
            ||.|.|..|:...:|....||.|::|.          .|.|                  ||    
  Fly    99 ASKTLNIKSTRRKNSIGCLNSFSSSPD----------SPGCYYTIAASAAPPSKSQSLPAHASIK 153

  Fly   389 ----------------LAHQLTAIELERLSHIGPEEFVQ-AFAKDYQQQAKDGSREANNSKCSGG 436
                            ||:|:|.::....:.|.|:|... |:.|      ||  :..|       
  Fly   154 QLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTK------KD--KHVN------- 203

  Fly   437 GGGSLNDMKKTRNLESYVQWFNRLSYLTASEIVKYPKKKQRVRIIEYWIETARECFNIGNFNSLM 501
                      |.|:.::.:.||..|:.|..||:...:.|||..||.::|:.|::...:.|.:||.
  Fly   204 ----------TPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLF 258

  Fly   502 AIIAGLNLAPIGRLKKTWA----KVQSA--KFSVLEHQMDPTSNFNSYRSTLKAAMWRSEGATEE 560
            |||:.:..|.|.||.||||    |.::|  :.|.:....|..:|..||..:|:..          
  Fly   259 AIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLP---------- 313

  Fly   561 RERIIIPFFSLFVKDLYFLN-----------EGCSNRLPN-----------NHINFEKCSQLAKQ 603
                .||:..||:.||.:::           |...|::.|           |:.:.:|.....|.
  Fly   314 ----CIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKY 374

  Fly   604 VMEFNEWKKVNCPFERLPNVIAYLQNSAVLNENTLS---MASFECEPPEN 650
            :.....       .|.|.|:....|....||....|   .:|..|...|:
  Fly   375 LTSIRY-------IEELQNIFEEDQYKRSLNLEPASPSGPSSSSCSSKES 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7369NP_649415.2 RasGEF_N 116..261 CDD:279012
RasGEF 388..649 CDD:214539 71/312 (23%)
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 67/282 (24%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.