DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33257 and CG11698

DIOPT Version :9

Sequence 1:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster


Alignment Length:276 Identity:67/276 - (24%)
Similarity:110/276 - (39%) Gaps:65/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYGQGLRFLLAQLVLVLLLSNAL----GRLHKRNGYHYRPQQPPPIHQGGYFEPHLPAVEPPEPE 61
            ||..........||.:|||||.|    ....:||...::|...|                     
  Fly     1 MYDARFPMRCDSLVTMLLLSNILLSTAAHPAQRNDPRFKPGSLP--------------------- 44

  Fly    62 KPQHSTKSYYTTSGGSSSVSSKGSGGYSIGSGLRSIAQGSADQAHSAVTNQHAAAKQAAYIAQNT 126
                     ..||..:|.|:||                 :|..|..|...|..||:.|.|.|:..
  Fly    45 ---------CKTSMKASQVASK-----------------AAKDAKDAKDAQPCAAEMAGYRAREM 83

  Fly   127 LAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHI 191
            ||..|.|||..|:|||.||:.:|.|..:..||..|.:......:.|:..||..|:.........:
  Fly    84 LADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSV 148

  Fly   192 SVLTAA-------VNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAA 249
            :::.:.       ::|.:.:|:.|::.:.|..:.|.:       ::.|:|::...:.:|:.|...
  Fly   149 NIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKA-------ARMRVEELHSCMCEAQKDLER 206

  Fly   250 TKESALKAANSAAAAQ 265
            .|:||.||.::|..||
  Fly   207 NKQSAKKANDAAKEAQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 DUF745 94..252 CDD:283087 39/164 (24%)
SNARE 195..240 CDD:304603 7/51 (14%)
CG11698NP_649787.2 DUF745 45..225 CDD:283087 53/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.