DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33257 and CG11693

DIOPT Version :9

Sequence 1:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster


Alignment Length:335 Identity:137/335 - (40%)
Similarity:183/335 - (54%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRFLLAQLVLVLLLSNALGRLHKRNGYHYR------PQQPPPIHQGGYFEPHLPAVEPPEPEKPQ 64
            |..||..|.||.:.:.  ||..||...||.      |..|||       .||.|...|.:....:
  Fly     5 LHLLLLALFLVAMPTQ--GRKIKRKEPHYHHHVNVPPPPPPP-------SPHGPGPVPQQTAVIE 60

  Fly    65 HSTKSY----------------------------YTTSGGSSSVSSKGSGGYSIGSGLRSIAQGS 101
            |....|                            ::..||...    |||||...:||||||:||
  Fly    61 HEVPPYTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGG----GSGGYLADNGLRSIAKGS 121

  Fly   102 ADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRE 166
            ||||.|||.:|:||.|||:|:|::||||||:|||.||.|.|.||:|:|..||.|:.||.:::..|
  Fly   122 ADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENE 186

  Fly   167 LEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKN 231
            |.||:.||.||:.||..||.|.:|:||||||:|||:|.:|.|::.::|...:||||..||.|:|.
  Fly   187 LTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKT 251

  Fly   232 RLEQVEEQLHQARVDYAATKESALKAANSAAAAQVNASKAAQHATIGLHESTNPSAHGHDGQELG 296
            :||..|.|.:.||:||..|:::|.||..||..|.:||:.||.||.:.|.|    :.|.||..:..
  Fly   252 KLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNANDAALHANVELAE----NVHIHDKSDRN 312

  Fly   297 GEEESYDEHL 306
            ..|...:..|
  Fly   313 VREPPRNHRL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33257NP_996107.1 DUF745 94..252 CDD:283087 88/157 (56%)
SNARE 195..240 CDD:304603 21/44 (48%)
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 96/179 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C6CE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016774
OrthoInspector 1 1.000 - - otm50159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.