DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33272 and CG33270

DIOPT Version :9

Sequence 1:NP_996045.1 Gene:CG33272 / 2768958 FlyBaseID:FBgn0053272 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_996050.1 Gene:CG33270 / 2768982 FlyBaseID:FBgn0053270 Length:88 Species:Drosophila melanogaster


Alignment Length:88 Identity:85/88 - (96%)
Similarity:87/88 - (98%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLFVVALIALAIQMASSASNTTTTDATTTTTTTTAASTTTTTTAASTHKKLCWRGNNWCHTRI 65
            |||||||||||||||:|||||.||||||||||||||||||||||||:||||||||||||||||||
  Fly     1 MKYLFVVALIALAIQVASSASTTTTTDATTTTTTTTAASTTTTTTASSTHKKLCWRGNNWCHTRI 65

  Fly    66 PKRKCKNPKRCHKTIVIVTHRKN 88
            |||||||||||||||||||||||
  Fly    66 PKRKCKNPKRCHKTIVIVTHRKN 88



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.