DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp73a and Obp58d

DIOPT Version :10

Sequence 1:NP_001097628.1 Gene:Obp73a / 2768955 FlyBaseID:FBgn0036681 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611711.1 Gene:Obp58d / 37609 FlyBaseID:FBgn0034770 Length:218 Species:Drosophila melanogaster


Alignment Length:42 Identity:8/42 - (19%)
Similarity:16/42 - (38%) Gaps:7/42 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DVASSGIYHPTLVPLEDK-------RIAGCLLHCVYAKNNAI 165
            |:....:.|...:|::..       |...|.:.|:|.:...|
  Fly    58 DLVKCFVIHSPKLPVDGDADIGKTLRFLSCFVECLYKQKKYI 99

Return to query results.
Submit another query.