DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp73a and Obp58c

DIOPT Version :10

Sequence 1:NP_001097628.1 Gene:Obp73a / 2768955 FlyBaseID:FBgn0036681 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster


Alignment Length:116 Identity:30/116 - (25%)
Similarity:43/116 - (37%) Gaps:41/116 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DKRIAG-CLLHCVYAKNNAIDQRGWPTLDGLVHFYSEGVHEHGFFMATLRSVNLCLRTMTARYGV 210
            |:.|.| |...||::|.|.:...   .||                |..:||:      .|.|:  
  Fly    73 DRAIRGTCFGKCVFSKLNLMKDN---NLD----------------MDAVRSL------FTERF-- 110

  Fly   211 NRKELPKKGESCDLAFDVC---SHMNTN------IFKDL--QFWAPFISYV 250
              .:.|:..:....|||.|   |..||:      :||.:  ||..|..|.|
  Fly   111 --PDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQFCDPKSSVV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp73aNP_001097628.1 None
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:472229 21/90 (23%)

Return to query results.
Submit another query.