DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp73a and Obp49a

DIOPT Version :10

Sequence 1:NP_001097628.1 Gene:Obp73a / 2768955 FlyBaseID:FBgn0036681 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster


Alignment Length:41 Identity:10/41 - (24%)
Similarity:22/41 - (53%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SVIRECQDEVRNKLVNEAYEILKEQVSQNQPPIDPNDDSID 85
            ::::.|.|.:||.  ::....:||..::.:||..|...:.|
  Fly   173 NMMKNCPDSIRND--SQQCTDMKEFFTKCKPPRGPPPSAED 211

Return to query results.
Submit another query.