DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp73a and Obp46a

DIOPT Version :10

Sequence 1:NP_001097628.1 Gene:Obp73a / 2768955 FlyBaseID:FBgn0036681 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_610574.1 Gene:Obp46a / 36088 FlyBaseID:FBgn0033508 Length:198 Species:Drosophila melanogaster


Alignment Length:67 Identity:18/67 - (26%)
Similarity:24/67 - (35%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LRTMTARYGVNRKELPKKGESCDL-----AFDVCS--HMNTNIFKDLQF-WAPFISYVNESRAIN 257
            |..:|| :...|...|...|.|:|     ..|.|.  |..:..|.|.|. |...|.|..:.....
  Fly    10 LLLLTA-FVTGRSTPPALDEDCELNSVDTMHDFCCDLHDESPQFSDCQMEWHEKIPYETDEEEQT 73

  Fly   258 YI 259
            |:
  Fly    74 YM 75

Return to query results.
Submit another query.