DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and Mpv17l

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:165 Identity:53/165 - (32%)
Similarity:85/165 - (51%) Gaps:9/165 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RYPFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVYAPTLYLWYKW 78
            |||:.||..:|..|:...:..||         ..:....|:....|.|.:....:....|:|.:.
Mouse    14 RYPWPTNVLLYAGLFSAGDALQQ---------RLRGGPADWRQTRRVATLAVTFHGNFNYVWLRL 69

  Fly    79 LDRAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEGSADIFLELREKFVPTFMRSCIFWL 143
            |:||.||.....::.|::.||.|..|..|:.||.|||:::|..||||:|::||..|:....::|.
Mouse    70 LERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQKFWNTYKSGLMYWP 134

  Fly   144 PAQALNFSLVAPRFRVIYMGICGLIWVNILCWTKR 178
            ..|..|||||...:|..|.|:|..:|...||::::
Mouse   135 FVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 23/61 (38%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 10/47 (21%)
Mpv17_PMP22 107..166 CDD:282035 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10768
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13547
Inparanoid 1 1.050 106 1.000 Inparanoid score I4923
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 1 1.000 - - oto93424
orthoMCL 1 0.900 - - OOG6_110111
Panther 1 1.100 - - LDO PTHR11266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5861
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.