DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and YOR292C

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_014935.3 Gene:YOR292C / 854467 SGDID:S000005818 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:48/212 - (22%)
Similarity:86/212 - (40%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LISGVRNL-------FHRY-----PFVTNSAIY----------GSLYVGAEYS--QQFASK---- 40
            |:.|:.::       |:.|     |.:.|...:          |..|...|.|  ..|.|:    
Yeast    93 LLFGISDILAQSIACFYSYHVDPIPQILNDTFHHVQNNRDVENGGGYESDELSIFNDFTSEHSSY 157

  Fly    41 ----------RWLATASKPEDIDYATIGRYAVMGTAV---YAPTLYLWYKWLDRAF-PGTTKVII 91
                      |.||| .|.:..|:...|.:...|..:   .||    |||:|:..: ...|.|.:
Yeast   158 TDNDDYPELDRPLAT-FKTDTFDFFRWGCFMFWGFFISFFQAP----WYKFLNFFYTEDPTVVQV 217

  Fly    92 VKKLVLDQFVLTPYLLTVFYAGMS-IMEGSADIFL--ELREKFVPTFMRSCIFWLPAQALNFSLV 153
            .::::.||.:.:|..|..|:...: :|||.....|  :::..::.|...:.:.|...|.:|| |:
Yeast   218 FERVLSDQLLYSPISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINF-LI 281

  Fly   154 APR-FRVIYMGICGLIW 169
            .|| |:..:....|::|
Yeast   282 MPRDFQAPFSSSVGVVW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 15/57 (26%)
YOR292CNP_014935.3 Mpv17_PMP22 243..303 CDD:397992 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.