DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12355 and SYM1

DIOPT Version :9

Sequence 1:NP_001097610.1 Gene:CG12355 / 2768954 FlyBaseID:FBgn0040805 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:50/192 - (26%)
Similarity:89/192 - (46%) Gaps:23/192 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFHRY-------PFVTNSAIYGSLYVGAEYSQQFASKRWLATASKPEDIDYATIGRYAVMGTAVY 68
            |.|.|       |..||:.:.|:|:...:.|.|..    ..|:...:..||....|..:.|:.::
Yeast     3 LLHLYEASLKRRPKTTNAIMTGALFGIGDVSAQLL----FPTSKVNKGYDYKRTARAVIYGSLIF 63

  Fly    69 APTLYLWYKWLD-----RAFPGTTKVIIVKKLVLDQFVLTPYLLTVFYAGMSIMEG-SADIF-LE 126
            :.....|||.|:     |..|......:|.::.:||....|..|..::..|||||| |.|:. |:
Yeast    64 SFIGDKWYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLK 128

  Fly   127 LREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMGICGLIWVNILCW-----TKRQSLPV 183
            ::|::.||.:.:...|...||:|||:|..:.|::.:.:..:.|...|.:     .::..:||
Yeast   129 IKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSKVMEKDKVPV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12355NP_001097610.1 Mpv17_PMP22 116..178 CDD:282035 20/68 (29%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55228
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.